Get hostname and Geo location
info for any IP



Whois Lookup
Get contact info for a domain/ip
Traceroute
Shows network route to host
Your iP is: 54.92.148.165 United States Near: Woodbridge, New Jersey, United States

This is where you are:

IP Information - 54.92.148.165

Host name: ec2-54-92-148-165.compute-1.amazonaws.com

Country: United States

Country Code: US

Region: NJ

City: Woodbridge

Latitude: 40.5525

Longitude: -74.2915

K. bryan is reporting 209.86.89.129

Hard to tell where this is coming from: Return-Path: <bounce@amazon.com> Received: from noehlo.host ([209.86.89.135]) by mdl-squeel.atl.sa.earthlink.net (EarthLink SMTP Server) with SMTP id 1Hr2Pc4wW3Nl34P0; Wed, 15 May 2019 18:56:39 -0400 (EDT) Received: from vxe.bestgrejames.org ([3.1.162.231]) by ibscan-wasp.atl.sa.earthlink.net (EarthLink SMTP Server) with ESMTP id 1Hr2Pb3ka3PGoUn0 for <kbryan@earthlink.net>; Wed, 15 May 2019 18:56:38 -0400 (EDT) From: "Free Samples_"<from@lolzteam.club> To: kbryan@earthlink.net 0, 0 Subject: Congrats! You've Been Selected for FREE Samples. Content-Transfer-Encoding: 7bit Content-Type: text/html; charset="UTF-8" X-Mailer: Microsoft Avondale Mailer Message-ID: <YP48mWjlRKHdVAy74FwKFpe9FzXO0FU3@partners.extranet.microsoft.com> Date: Wed, 15 May 2019 22:40:08 +0200 X-ELNK-Received-Info: sbv=0; sbrc=.0; sbf=00; sbw=000; X-ELNK-Received-Info: spv=1; X-ELNK-AV: 0 X-ELNK-Info: sbv=1; sbrc=-0; sbf=ee; sbw=000; <img alt='' src='http://lolzteam.club/r.php?t=o&d=24852&l=788&c=145517' width='1px' height='1px' style='visibility:hidden'/>

IP identified as: Spammers IP, Reported on: 15th, May. 2019
alain lubat is reporting 80.12.242.127

I receive a fishing mail of this ip 86.12.242.127 which seems managed by your services. This is a scam, thank you for doing the necessary. here after the mail: Return-Path: <alain.lubat@orange.fr> Received: from smtp.smtpout.orange.fr ([80.12.242.127]) by mx.kundenserver.de (mxeue010 [212.227.15.41]) with ESMTPS (Nemesis) id 1MLyO9-1h8vM63d33-00HywN for <alain@almail.net>; Wed, 15 May 2019 13:06:55 +0200 Received: from opme11dob39nd1.rouen.francetelecom.fr ([10.110.50.216]) by mwinf5d09 with ME id Cb6v2000J4fsX0S03b6vGd; Wed, 15 May 2019 13:06:55 +0200 X-ME-Helo: opme11dob39nd1.rouen.francetelecom.fr X-ME-Date: Wed, 15 May 2019 13:06:55 +0200 X-ME-IP: 10.110.50.216 X-Sieve: Pigeonhole Sieve 0.4.24 (5a7e9e62) X-Sieve-Redirected-From: alain.lubat@orange.fr Received: from opme11dod16nd1.rouen.francetelecom.fr ([10.79.5.104]) by opme11dob39nd1.rouen.francetelecom.fr with LMTP id wEQqEs/y21xfewAAVm+2Zg ; Wed, 15 May 2019 13:06:55 +0200 Received: from opme11ppr07nd1.rouen.francetelecom.fr ([10.79.5.104]) by opme11dod16nd1.rouen.francetelecom.fr with LMTP id GIb6Ec/y21xvDAAASbndxA ; Wed, 15 May 2019 13:06:55 +0200 Received: from mwinf5c29 ([10.79.5.104]) by opme11ppr07nd1.rouen.francetelecom.fr with LMTP id AF60EM/y21xJDQAA4TOxhQ ; Wed, 15 May 2019 13:06:55 +0200 Received: from campanile-le-havre-centre.fr ([86.229.207.124]) by mwinf5c29 with ME id Cb6u2002c2haSWm01b6uTE; Wed, 15 May 2019 13:06:55 +0200 X-bcc: alain.lubat@orange.fr X-ME-engine: default X-me-spamcause: (0)(0000)gggruggvucftvghtrhhoucdtuddrgeduuddrleekgdefjecutefuodetggdotefrodftvfcurfhrohhfihhlvgemucfogfdpggftiffpkfenuceurghilhhouhhtmecugedttdenucenucfjughrpeffhffgvfgtufggsegrkedtredttdejnecuhfhrohhmpehkmhgrrhhtvghlsegtrghmphgrnhhilhgvqdhlvgdqhhgrvhhrvgdqtggvnhhtrhgvrdhfrhenucfkphepkeeirddvvdelrddvtdejrdduvdegnecurfgrrhgrmhephhgvlhhopegtrghmphgrnhhilhgvqdhlvgdqhhgrvhhrvgdqtggvnhhtrhgvrdhfrhdpihhnvghtpeekiedrvddvledrvddtjedruddvgedpmhgrihhlfhhrohhmpehkmhgrrhhtvghlsegtrghmphgrnhhilhgvqdhlvgdqhhgrvhhrvgdqtggvnhhtrhgvrdhfrhdprhgtphhtthhopegrlhgrihhnrdhluhgsrghtsehorhgrnhhgvgdrfhhrnecuvehluhhsthgvrhfuihiivgeptd X-me-spamlevel: not-spam Message-ID: <76a0ebdaef157a20655a6f7948b27990@mwinf5c29.me-wanadoo.net> Date: Wed, 15 May 2019 11:06:54 +0000 X-GIRAUD: 5e142c1b-b0e4-43a1-9dbe-553bd0ef4297 From: kmartel@campanile-le-havre-centre.fr X-SCHMITT: 267935 X-Antivirus-Status: Clean Content-Transfer-Encoding: 8bit X-GUICHARD: 8W0UizEG X-Antivirus: Avast (VPS 131447-4, 15/05/2019), Outbound message To: =?utf-8?Q?alai?= <alain.lubat@orange.fr> Content-Type: multipart/alternative; boundary="------NextPart-e4hhjxio4uhxhe9xwvcubmdsrwz67snt" Subject: =?utf-8?B?UmVjb3V2cmVtZW50?= MIME-Version: 1.0 Envelope-To: <alain@almail.net> X-Spam-Flag: NO X-UI-Filterresults: notjunk:1;V03:K0:u+/PBG4Ihkk=:TQiE2ArcjSlSKk73WtI4jhkp0O 537DKsfLYqBOHKaTAiwxggE+IZGRoWbDeVOpr+r35UswpTLQ/TZnRgZABaXd8aEeW4+6b3dBo VudNC3rATno0TfRwONWX24xT7R0HTtLuvTjt0P12oZofqOz8GWscM1dKawRjZX/DSyGy52F8J 3oynrHAbdEP2hIF2KwCS3K9Qw1rUV5CZy9JXDbKaW4TR0vLarYJxxzHCktQPn/WF10ekMJ6M/ IqjrsmRXJXJsa2auGnDJodzjZz62CTiVGZ7OrRwZ8zjcZWSFtenm7pPoYYitpUsVk77RnAtLL QpsQvhL+x8vIMKoIMAD8Fn+JJZtHjXmfvarRwhQulIWRorV6mMu0ol57DgKh9luXJEHDFmxeR VhrCNiOcZhDc6dumrhL4jhaqFEpfypXmky9QzhGpxmboMWeHjEAC9EGn9Ox8Fayl94XCu7bgJ cHWFLqBeq9KeJvWOrPTlWC/uU/mS9Qj9Q1Sx32CEHI9lVOmAc22NbuvupeoFTsj2bHB1SdU2h a8IEj6XJHSQxCS3gIWK8iFtjYOzDxj94rr7TNYixAVqKR5sMmzT5O56mgXD9fxJboAK/RPXsS ZuHd2nO+i9lAHlk84CNdUqeLLVu7hj7AWDGsutYh9XTI+3FvzE3zbMfJ8KVGnaga9tACOK68k 1roaq2EemK32aZCwm6NLD2UMDiLq9zjcIQNZkF+1uBxzvU9ePtCEjUMi3YNkwhAL/xXnk4/wF aPynWIIFcqMweXN1jYRtaiNnwCcZi5SSmu1HzmEDAxYKBV4N0UVCbntmIuf80RR8d1G1SpisG d2g65H7ZUyVHqX6VvmqO9wyN4xBBO36UUxxTGpzyaE/QCpS+u9UhMOV/Ny4ySVzmSA2tYRb7P sBkcWQP2kG1gUT10MLu8r1q14GHP6/sADKp2m5sWS7bCw4LUPyQqUYwFEeYO0J+LvzGR9v1nq i9/Tr9sqPnL9v+G9s2IOuwCPXaTIwsdlZG0QKWmUwAETsXA7N+c/sFdvH4TI3PIV3mpntca0T yZsJ2CnhVNSYBAjGY1AF28L3Q0a2h0lZ5YETQM5u9dpxLzZ1RaNIafiTBTHvze/ycBxSchm57 CR9G1vqDMLP0bxgspvsW4q0g8KmUAgG1LXiz9Y+NijQEMyl8TfV+9vwI6QTVCeTnE+7vtYIO0 Ut/9CcG81DExm9sRO2a8Za9GOFvhlOqKdS2+cDfjaOo8Ho0KxcVYU1wM/EAHpTGs+oOHWJpGD Ccw4LUUBqWcYUNPosVBmH8JV3/CCdZid4Kxnq/L3eHN5W9E2h78Mb+ySTmBPp1xVSBGL/tjdU UWLh7q3jJPbsX8rS2UEuFvPkV7VrWBN0IdQzF2QnFZgNuHVVz4cRLh27kNKpqJXMPuKx+b6U7 76agSZCN2pXyBhl0JATmKk7Ftu3hMpHO+ibvGD8MxfldJfmhS++jLe1uNL7pIf3sA9nktbt83 XyVswn4iucOvth88H3NGVGbwKEevBzfTWv1MOBTlsrg2N22OS+qoAMneqZQVWdAh3T4WT8WLz dN5HI7b5W0A5t64H9Lkg= --------NextPart-e4hhjxio4uhxhe9xwvcubmdsrwz67snt Content-Type: text/plain; charset=utf-8 Content-Transfer-Encoding: 8bit Madame, Monsieur, Nous sommes mandatés pour recouvrer le solde débiteur de votre compte, pour un montant de 812,4�¬ (non-paiement de votre crédit à la consommation). Le détail des sommes dues est disponible dans votre ordonnance d'injonction de payer. Nous vous mettons en demeure de régler la somme de 812,4�¬ avant le 16 mai 2019. En vertu du mandat qui nous a été confié dans le cadre d'un recouvrement amiable nous agissons conformément à la loi du 09/07/1991 (art. 32*). Aucuns frais ne vous est réclamé à ce stade de la procédure. Nature de la créance : Non-paiement de votre crédit à la consommation MONTANT TTC : 812,4�¬ Date de limite de paiement : Le 19 mai 2019 Vous pouvez régulariser votre situation avec votre identifiant personnel : 741975 et votre code confidentiel : 662399 par CARTE BANCAIRE soit : * auprès de votre créancier * au numéro indiqué dans l'en-tête de votre ordonnance. En cas de difficultés, vous pouvez contacter un gestionnaire de notre service recouvrement du lundi au vendredi, de 08h00 à 19h00 sans interruption. Sans règlement ou contact de votre part dans le délai imparti, vous vous exposez à la résiliation contentieuse de votre contrat conformément aux conditions générales de ventes et nous serons contraints de transmettre votre dossier à notre service juridique chargé d'engager une procédure contentieuse à votre encontre et qui pourra éventuellement saisir le tribunal afin d'obtenir un titre exécutoire, ce qui ajouterait au principal de la créance les dommages et intérêts légaux, ainsi que ceux demandés au titre de l'Article 700 du Nouveau Code de Procédure Civile. Veuillez agréer, Madame, Monsieur, nos salutations distinguées. Mr KLEIN MARTELService Recouvrement Amiable France-Créances Nota : il est impossible de répondre à ce message électronique pour raison de sécurité et de confidentialité des informations vous concernant. --------NextPart-e4hhjxio4uhxhe9xwvcubmdsrwz67snt Content-Type: text/html; charset=utf-8 Content-Transfer-Encoding: 8bit Madame, Monsieur,<br> <br> Nous sommes mandatés pour recouvrer le solde débiteur de votre compte, pour un montant de 812,4�¬ (non-paiement de votre crédit à la consommation).<br> <br> Le détail des sommes dues est disponible dans votre <b><a style="color: blue;" href="//frama.link/LkFVpJga?13764">ordonnance d'injonction de payer</a></b>.<br> <br> Nous vous mettons en demeure de régler la somme de 812,4�¬ avant le 16 mai 2019.<br> <br> En vertu du mandat qui nous a été confié dans le cadre d'un recouvrement amiable nous agissons conformément à la loi du 09/07/1991 (art. 32*). Aucuns frais ne vous est réclamé à ce stade de la procédure.<br> <br> Nature de la créance : Non-paiement de votre crédit à la consommation<br> MONTANT TTC : 812,4�¬<br> Date de limite de paiement : Le 19 mai 2019<br> <br> Vous pouvez régulariser votre situation avec votre identifiant personnel : 741975 et votre code confidentiel : 662399 par CARTE BANCAIRE soit :<br> * auprès de votre créancier<br> * au numéro indiqué dans l'en-tête de <b><a style="color: blue;" href="//frama.link/LkFVpJga?13764">votre ordonnance</a></b>.<br> <br> En cas de difficultés, vous pouvez contacter un gestionnaire de notre service recouvrement du lundi au vendredi, de 08h00 à 19h00 sans interruption.<br> <br> Sans règlement ou contact de votre part dans le délai imparti, vous vous exposez à la résiliation contentieuse de votre contrat conformément aux conditions générales de ventes et nous serons contraints de transmettre votre dossier à notre service juridique chargé d'engager une procédure contentieuse à votre encontre et qui pourra éventuellement saisir le tribunal afin d'obtenir un titre exécutoire, ce qui ajouterait au principal de la créance les dommages et intérêts légaux, ainsi que ceux demandés au titre de l'Article 700 du Nouveau Code de Procédure Civile.<br> <br> Veuillez agréer, Madame, Monsieur, nos salutations distinguées.<br> <br> Mr KLEIN MARTEL<br> Service Recouvrement Amiable<br> France-Créances<br> <br> <br> Nota : il est impossible de répondre à ce message électronique pour raison de sécurité et de confidentialité des informations vous concernant. --------NextPart-e4hhjxio4uhxhe9xwvcubmdsrwz67snt--

Reported on: 15th, May. 2019
Office ip is reporting 92.184.102.138

Mod passe click

IP identified as: Office IP, Reported on: 14th, May. 2019
Fabian Sepulveda is reporting 46.161.119.252

I’ve been hacked...here’s the emails! https://mail.google.com/mail/mu/mp/758/#cv/All%20Mail/16aa313028967a39

IP identified as: Mobile device IP, Reported on: 14th, May. 2019
Fabian sepulveda is reporting 46.161.119.252

I’ve been hacked by this address. Ransomware... He’s demanding money in bit coin.... Here’s email message e been encrypted Inbox Add star Encognito Sepulveda<encognitos@gmail.com> Fri, May 10, 2019 at 11:48 AM To: Decryptyourdata@qq.com Reply | Reply to all | Forward | Print | Delete | Show original Hello, Please help me decrypt my files. My son was playing with my computer. I got home from a long trip, across country , and found my computer unusable. Please I plead w you to help me. All I have in that computer are old pictures I’ve been storing throughout the years. All the memories I have of my past loved ones. Have some compassion, this is a horrible thing y’all did to me. I have no money to pay you. I’m barely surviving in this cruel world. I just want my pictures , you can keep everything else. Please. Add star Godfather<decryptyourdata@qq.com> Fri, May 10, 2019 at 12:02 PM To: Encognito Sepulveda <encognitos@gmail.com> Reply | Reply to all | Forward | Print | Delete | Show original I’m an email operator. I'll try to answer all your questions and help you to decrypt files. To start answer: 1. How many computers with local disks are encrypted? 2. How many external hard drives or NAS are encrypted? 3. Write your ID. (you can find it in the name of the files) ------------------ Original ------------------ From: "Encognito Sepulveda";<encognitos@gmail.com>; Send time: Saturday, May 11, 2019 2:48 AM To: "Godfather"<Decryptyourdata@qq.com>; Subject: My files have been encrypted - Show quoted text - Reply | Reply to all | Forward | Print | Delete | Show original Unstarred Encognito Sepulveda Fri, May 10, 2019 at 3:35 PM Add star Godfather<decryptyourdata@qq.com> Sat, May 11, 2019 at 12:22 AM To: Encognito Sepulveda <encognitos@gmail.com> Reply | Reply to all | Forward | Print | Delete | Show original 1. Decoding cost The cost of decryption is 6500 $. We receive payment only in BITCOINS. (Bitcoin is a form of digital currency) All your Remote desktop passwords hacked. Change all user passwords to more harder. Immediately! 2. Attention! Do not rename encrypted files. Do not try to decrypt your data using third party software, it may cause permanent data loss. Do not trust anyone! Only we have keys to your files! Without this keys restore your data is impossible. 3. Free decryption as guarantee You can send us up to 1 file for free decryption. Size of file must be less than 1 Mb (non archived). We don`t decrypt for test DATABASE, XLS and other important files. Remember this. 4. Decryption process: To decrypt the files, transfer money to our bitcoin wallet number: "request it from us before payment". As we receive the money we will send you: 1. Decryption program. 2. Detailed instruction for decryption. 3. And individual keys for decrypting your files. 5. The process of buying bitcoins: The easiest way to buy bitcoins: https://localbitcoins.com/ https://www.bitpanda.com/ https://paxful.com/ https://www.abra.com/ FOR CHINA: https://www.huobi.com/ https://www.bitoex.com/ IMPORTANT! Don`t use coinbase! it take more than 2 week to make coinbase verification. ------------------ Original ------------------ From: "Encognito Sepulveda";<encognitos@gmail.com>; Send time: Saturday, May 11, 2019 6:35 AM To: "Godfather"<decryptyourdata@qq.com>; Subject: Re: My files have been encrypted

IP identified as: Wireless IP, Reported on: 14th, May. 2019
RITCollege is reporting 173.197.158.9

This is RIT Engg College

IP identified as: School/University IP, Reported on: 12th, May. 2019
Ivan Brouillette is reporting 74.58.114.54

Si je recherche mon adresse IP c'est 74.58.11.54 et avec cette recherche je voit que quelqu'un d'autre ce sert de mon adresse

IP identified as: This is my IP, Reported on: 11th, May. 2019
kelly swann is reporting 174.255.6.81

jim mcclure 304-590-1034 already told everyone about his behavior things, but he been writing messages as me his digital alliance and his voice recording and this phone is new that he bought and he puts things in this phone now he talking about livewire pixels hubs

IP identified as: Wireless IP, Reported on: 11th, May. 2019
kelly swann is reporting 174.255.6.81

jim mcclure is been doing lies and writing messages as myself, i do not have a verizon phone

IP identified as: Residentail IP, Reported on: 11th, May. 2019
Alycia keating is reporting 32.217.29.215

32.217.29.215 just attempted to hack into my google account. Thanks.

IP identified as: Hackers IP, Reported on: 9th, May. 2019
Evandro Ponce Munhoz is reporting 157.230.127.159

This IP is a spammer. I receive an average of 20 unsolicited emails a day. Unable to block due to revolving IP Address associated with the same owner of this IP.

IP identified as: Spammers IP, Reported on: 7th, May. 2019
Evandro Ponce Munhoz is reporting 157.230.107.146

This is a spammer. I receive an average of 20 unsolicited emails a day. Unable to block due to revolving IP Address associated to the same owner of this IP.

IP identified as: Spammers IP, Reported on: 7th, May. 2019
Evandro Ponce Munhoz is reporting 157.230.107.146

This is a spammer. I receive an average of 20 unsolicited emails a day.

IP identified as: Spammers IP, Reported on: 7th, May. 2019
Evandro Ponce Munhoz is reporting 157.230.112.245

This IP is from a spammer. I receive an average of 20 emails a day from this Spammer.

IP identified as: Spammers IP, Reported on: 7th, May. 2019
www.orange.ma is reporting ..

102.98.58.136

Reported on: 5th, May. 2019
Larry is reporting 98.229.122.126

Someone is using my ip address i want an address a name im going to police i e had my idenith stolen an am fed up my 978 75150-/ if u want to call me

IP identified as: This is my IP, Reported on: 5th, May. 2019
Bran is reporting 103.231.200.158

103.231.200.158

IP identified as: Hackers IP, Reported on: 3rd, May. 2019
Pagal is reporting 240238092595405330518501

Hello

IP identified as: Hackers IP, Reported on: 2nd, May. 2019
Glen is reporting 194.15.33.241

Trying to steal AOL logins. Have reported to domain and to Host (Ripe.net) and still happens. Ripe takes no responsibility for how their network is used

IP identified as: Spammers IP, Reported on: 1st, May. 2019
Jim is reporting 116.203.120.229

Seeing a DoS Atac - Syn/ACK Scan from 116.203.120.229, hitting port 1.

IP identified as: Hackers IP, Reported on: 1st, May. 2019
Jim is reporting 111.123.49.224

Seeing DoS Attack - SYN/ACK Scan from 111.123.49.224.

IP identified as: Hackers IP, Reported on: 1st, May. 2019
dave is reporting 195.92.25.218

compromised / hacked email account today

IP identified as: Hackers IP, Reported on: 29th, Apr. 2019
HAHAHAHAHA is reporting 91.188.244.201

@echo off :1 wirus %username% не ставьте под угрозу свой стволовый аккаунт goto wirus

Reported on: 27th, Apr. 2019
jorg is reporting 177.20.229.36

177.20.229.36

IP identified as: Hackers IP, Reported on: 26th, Apr. 2019
Marge is reporting 54.218.173.2

daily dose of smut/phishing from amazonaws.com

Reported on: 26th, Apr. 2019
Previous 1 2  3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 Next 
List of Class A IP ranges (click to view)
* 1.0.0.0 - 1.255.255.255 (1.0.0.0/8)
* 2.0.0.0 - 2.255.255.255 (2.0.0.0/8)
* 3.0.0.0 - 3.255.255.255 (3.0.0.0/8)
* 4.0.0.0 - 4.255.255.255 (4.0.0.0/8)
* 5.0.0.0 - 5.255.255.255 (5.0.0.0/8)
* 6.0.0.0 - 6.255.255.255 (6.0.0.0/8)
* 7.0.0.0 - 7.255.255.255 (7.0.0.0/8)
* 8.0.0.0 - 8.255.255.255 (8.0.0.0/8)
* 9.0.0.0 - 9.255.255.255 (9.0.0.0/8)
* 10.0.0.0 - 10.255.255.255 (10.0.0.0/8)
* 11.0.0.0 - 11.255.255.255 (11.0.0.0/8)
* 12.0.0.0 - 12.255.255.255 (12.0.0.0/8)
* 13.0.0.0 - 13.255.255.255 (13.0.0.0/8)
* 14.0.0.0 - 14.255.255.255 (14.0.0.0/8)
* 15.0.0.0 - 15.255.255.255 (15.0.0.0/8)
* 16.0.0.0 - 16.255.255.255 (16.0.0.0/8)
* 17.0.0.0 - 17.255.255.255 (17.0.0.0/8)
* 18.0.0.0 - 18.255.255.255 (18.0.0.0/8)
* 19.0.0.0 - 19.255.255.255 (19.0.0.0/8)
* 20.0.0.0 - 20.255.255.255 (20.0.0.0/8)
* 21.0.0.0 - 21.255.255.255 (21.0.0.0/8)
* 22.0.0.0 - 22.255.255.255 (22.0.0.0/8)
* 23.0.0.0 - 23.255.255.255 (23.0.0.0/8)
* 24.0.0.0 - 24.255.255.255 (24.0.0.0/8)
* 25.0.0.0 - 25.255.255.255 (25.0.0.0/8)
* 26.0.0.0 - 26.255.255.255 (26.0.0.0/8)
* 27.0.0.0 - 27.255.255.255 (27.0.0.0/8)
* 28.0.0.0 - 28.255.255.255 (28.0.0.0/8)
* 29.0.0.0 - 29.255.255.255 (29.0.0.0/8)
* 30.0.0.0 - 30.255.255.255 (30.0.0.0/8)
* 31.0.0.0 - 31.255.255.255 (31.0.0.0/8)
* 32.0.0.0 - 32.255.255.255 (32.0.0.0/8)
* 33.0.0.0 - 33.255.255.255 (33.0.0.0/8)
* 34.0.0.0 - 34.255.255.255 (34.0.0.0/8)
* 35.0.0.0 - 35.255.255.255 (35.0.0.0/8)
* 36.0.0.0 - 36.255.255.255 (36.0.0.0/8)
* 37.0.0.0 - 37.255.255.255 (37.0.0.0/8)
* 38.0.0.0 - 38.255.255.255 (38.0.0.0/8)
* 39.0.0.0 - 39.255.255.255 (39.0.0.0/8)
* 40.0.0.0 - 40.255.255.255 (40.0.0.0/8)
* 41.0.0.0 - 41.255.255.255 (41.0.0.0/8)
* 42.0.0.0 - 42.255.255.255 (42.0.0.0/8)
* 43.0.0.0 - 43.255.255.255 (43.0.0.0/8)
* 44.0.0.0 - 44.255.255.255 (44.0.0.0/8)
* 45.0.0.0 - 45.255.255.255 (45.0.0.0/8)
* 46.0.0.0 - 46.255.255.255 (46.0.0.0/8)
* 47.0.0.0 - 47.255.255.255 (47.0.0.0/8)
* 48.0.0.0 - 48.255.255.255 (48.0.0.0/8)
* 49.0.0.0 - 49.255.255.255 (49.0.0.0/8)
* 50.0.0.0 - 50.255.255.255 (50.0.0.0/8)
* 51.0.0.0 - 51.255.255.255 (51.0.0.0/8)
* 52.0.0.0 - 52.255.255.255 (52.0.0.0/8)
* 53.0.0.0 - 53.255.255.255 (53.0.0.0/8)
* 54.0.0.0 - 54.255.255.255 (54.0.0.0/8)
* 55.0.0.0 - 55.255.255.255 (55.0.0.0/8)
* 56.0.0.0 - 56.255.255.255 (56.0.0.0/8)
* 57.0.0.0 - 57.255.255.255 (57.0.0.0/8)
* 58.0.0.0 - 58.255.255.255 (58.0.0.0/8)
* 59.0.0.0 - 59.255.255.255 (59.0.0.0/8)
* 60.0.0.0 - 60.255.255.255 (60.0.0.0/8)
* 61.0.0.0 - 61.255.255.255 (61.0.0.0/8)
* 62.0.0.0 - 62.255.255.255 (62.0.0.0/8)
* 63.0.0.0 - 63.255.255.255 (63.0.0.0/8)
* 64.0.0.0 - 64.255.255.255 (64.0.0.0/8)
* 65.0.0.0 - 65.255.255.255 (65.0.0.0/8)
* 66.0.0.0 - 66.255.255.255 (66.0.0.0/8)
* 67.0.0.0 - 67.255.255.255 (67.0.0.0/8)
* 68.0.0.0 - 68.255.255.255 (68.0.0.0/8)
* 69.0.0.0 - 69.255.255.255 (69.0.0.0/8)
* 70.0.0.0 - 70.255.255.255 (70.0.0.0/8)
* 71.0.0.0 - 71.255.255.255 (71.0.0.0/8)
* 72.0.0.0 - 72.255.255.255 (72.0.0.0/8)
* 73.0.0.0 - 73.255.255.255 (73.0.0.0/8)
* 74.0.0.0 - 74.255.255.255 (74.0.0.0/8)
* 75.0.0.0 - 75.255.255.255 (75.0.0.0/8)
* 76.0.0.0 - 76.255.255.255 (76.0.0.0/8)
* 77.0.0.0 - 77.255.255.255 (77.0.0.0/8)
* 78.0.0.0 - 78.255.255.255 (78.0.0.0/8)
* 79.0.0.0 - 79.255.255.255 (79.0.0.0/8)
* 80.0.0.0 - 80.255.255.255 (80.0.0.0/8)
* 81.0.0.0 - 81.255.255.255 (81.0.0.0/8)
* 82.0.0.0 - 82.255.255.255 (82.0.0.0/8)
* 83.0.0.0 - 83.255.255.255 (83.0.0.0/8)
* 84.0.0.0 - 84.255.255.255 (84.0.0.0/8)
* 85.0.0.0 - 85.255.255.255 (85.0.0.0/8)
* 86.0.0.0 - 86.255.255.255 (86.0.0.0/8)
* 87.0.0.0 - 87.255.255.255 (87.0.0.0/8)
* 88.0.0.0 - 88.255.255.255 (88.0.0.0/8)
* 89.0.0.0 - 89.255.255.255 (89.0.0.0/8)
* 90.0.0.0 - 90.255.255.255 (90.0.0.0/8)
* 91.0.0.0 - 91.255.255.255 (91.0.0.0/8)
* 92.0.0.0 - 92.255.255.255 (92.0.0.0/8)
* 93.0.0.0 - 93.255.255.255 (93.0.0.0/8)
* 94.0.0.0 - 94.255.255.255 (94.0.0.0/8)
* 95.0.0.0 - 95.255.255.255 (95.0.0.0/8)
* 96.0.0.0 - 96.255.255.255 (96.0.0.0/8)
* 97.0.0.0 - 97.255.255.255 (97.0.0.0/8)
* 98.0.0.0 - 98.255.255.255 (98.0.0.0/8)
* 99.0.0.0 - 99.255.255.255 (99.0.0.0/8)
* 100.0.0.0 - 100.255.255.255 (100.0.0.0/8)
* 101.0.0.0 - 101.255.255.255 (101.0.0.0/8)
* 102.0.0.0 - 102.255.255.255 (102.0.0.0/8)
* 103.0.0.0 - 103.255.255.255 (103.0.0.0/8)
* 104.0.0.0 - 104.255.255.255 (104.0.0.0/8)
* 105.0.0.0 - 105.255.255.255 (105.0.0.0/8)
* 106.0.0.0 - 106.255.255.255 (106.0.0.0/8)
* 107.0.0.0 - 107.255.255.255 (107.0.0.0/8)
* 108.0.0.0 - 108.255.255.255 (108.0.0.0/8)
* 109.0.0.0 - 109.255.255.255 (109.0.0.0/8)
* 110.0.0.0 - 110.255.255.255 (110.0.0.0/8)
* 111.0.0.0 - 111.255.255.255 (111.0.0.0/8)
* 112.0.0.0 - 112.255.255.255 (112.0.0.0/8)
* 113.0.0.0 - 113.255.255.255 (113.0.0.0/8)
* 114.0.0.0 - 114.255.255.255 (114.0.0.0/8)
* 115.0.0.0 - 115.255.255.255 (115.0.0.0/8)
* 116.0.0.0 - 116.255.255.255 (116.0.0.0/8)
* 117.0.0.0 - 117.255.255.255 (117.0.0.0/8)
* 118.0.0.0 - 118.255.255.255 (118.0.0.0/8)
* 119.0.0.0 - 119.255.255.255 (119.0.0.0/8)
* 120.0.0.0 - 120.255.255.255 (120.0.0.0/8)
* 121.0.0.0 - 121.255.255.255 (121.0.0.0/8)
* 122.0.0.0 - 122.255.255.255 (122.0.0.0/8)
* 123.0.0.0 - 123.255.255.255 (123.0.0.0/8)
* 124.0.0.0 - 124.255.255.255 (124.0.0.0/8)
* 125.0.0.0 - 125.255.255.255 (125.0.0.0/8)
* 126.0.0.0 - 126.255.255.255 (126.0.0.0/8)
* 127.0.0.0 - 127.255.255.255 (127.0.0.0/8)
* 128.0.0.0 - 128.255.255.255 (128.0.0.0/8)
* 129.0.0.0 - 129.255.255.255 (129.0.0.0/8)
* 130.0.0.0 - 130.255.255.255 (130.0.0.0/8)
* 131.0.0.0 - 131.255.255.255 (131.0.0.0/8)
* 132.0.0.0 - 132.255.255.255 (132.0.0.0/8)
* 133.0.0.0 - 133.255.255.255 (133.0.0.0/8)
* 134.0.0.0 - 134.255.255.255 (134.0.0.0/8)
* 135.0.0.0 - 135.255.255.255 (135.0.0.0/8)
* 136.0.0.0 - 136.255.255.255 (136.0.0.0/8)
* 137.0.0.0 - 137.255.255.255 (137.0.0.0/8)
* 138.0.0.0 - 138.255.255.255 (138.0.0.0/8)
* 139.0.0.0 - 139.255.255.255 (139.0.0.0/8)
* 140.0.0.0 - 140.255.255.255 (140.0.0.0/8)
* 141.0.0.0 - 141.255.255.255 (141.0.0.0/8)
* 142.0.0.0 - 142.255.255.255 (142.0.0.0/8)
* 143.0.0.0 - 143.255.255.255 (143.0.0.0/8)
* 144.0.0.0 - 144.255.255.255 (144.0.0.0/8)
* 145.0.0.0 - 145.255.255.255 (145.0.0.0/8)
* 146.0.0.0 - 146.255.255.255 (146.0.0.0/8)
* 147.0.0.0 - 147.255.255.255 (147.0.0.0/8)
* 148.0.0.0 - 148.255.255.255 (148.0.0.0/8)
* 149.0.0.0 - 149.255.255.255 (149.0.0.0/8)
* 150.0.0.0 - 150.255.255.255 (150.0.0.0/8)
* 151.0.0.0 - 151.255.255.255 (151.0.0.0/8)
* 152.0.0.0 - 152.255.255.255 (152.0.0.0/8)
* 153.0.0.0 - 153.255.255.255 (153.0.0.0/8)
* 154.0.0.0 - 154.255.255.255 (154.0.0.0/8)
* 155.0.0.0 - 155.255.255.255 (155.0.0.0/8)
* 156.0.0.0 - 156.255.255.255 (156.0.0.0/8)
* 157.0.0.0 - 157.255.255.255 (157.0.0.0/8)
* 158.0.0.0 - 158.255.255.255 (158.0.0.0/8)
* 159.0.0.0 - 159.255.255.255 (159.0.0.0/8)
* 160.0.0.0 - 160.255.255.255 (160.0.0.0/8)
* 161.0.0.0 - 161.255.255.255 (161.0.0.0/8)
* 162.0.0.0 - 162.255.255.255 (162.0.0.0/8)
* 163.0.0.0 - 163.255.255.255 (163.0.0.0/8)
* 164.0.0.0 - 164.255.255.255 (164.0.0.0/8)
* 165.0.0.0 - 165.255.255.255 (165.0.0.0/8)
* 166.0.0.0 - 166.255.255.255 (166.0.0.0/8)
* 167.0.0.0 - 167.255.255.255 (167.0.0.0/8)
* 168.0.0.0 - 168.255.255.255 (168.0.0.0/8)
* 169.0.0.0 - 169.255.255.255 (169.0.0.0/8)
* 170.0.0.0 - 170.255.255.255 (170.0.0.0/8)
* 171.0.0.0 - 171.255.255.255 (171.0.0.0/8)
* 172.0.0.0 - 172.255.255.255 (172.0.0.0/8)
* 173.0.0.0 - 173.255.255.255 (173.0.0.0/8)
* 174.0.0.0 - 174.255.255.255 (174.0.0.0/8)
* 175.0.0.0 - 175.255.255.255 (175.0.0.0/8)
* 176.0.0.0 - 176.255.255.255 (176.0.0.0/8)
* 177.0.0.0 - 177.255.255.255 (177.0.0.0/8)
* 178.0.0.0 - 178.255.255.255 (178.0.0.0/8)
* 179.0.0.0 - 179.255.255.255 (179.0.0.0/8)
* 180.0.0.0 - 180.255.255.255 (180.0.0.0/8)
* 181.0.0.0 - 181.255.255.255 (181.0.0.0/8)
* 182.0.0.0 - 182.255.255.255 (182.0.0.0/8)
* 183.0.0.0 - 183.255.255.255 (183.0.0.0/8)
* 184.0.0.0 - 184.255.255.255 (184.0.0.0/8)
* 185.0.0.0 - 185.255.255.255 (185.0.0.0/8)
* 186.0.0.0 - 186.255.255.255 (186.0.0.0/8)
* 187.0.0.0 - 187.255.255.255 (187.0.0.0/8)
* 188.0.0.0 - 188.255.255.255 (188.0.0.0/8)
* 189.0.0.0 - 189.255.255.255 (189.0.0.0/8)
* 190.0.0.0 - 190.255.255.255 (190.0.0.0/8)
* 191.0.0.0 - 191.255.255.255 (191.0.0.0/8)
* 192.0.0.0 - 192.255.255.255 (192.0.0.0/8)
* 193.0.0.0 - 193.255.255.255 (193.0.0.0/8)
* 194.0.0.0 - 194.255.255.255 (194.0.0.0/8)
* 195.0.0.0 - 195.255.255.255 (195.0.0.0/8)
* 196.0.0.0 - 196.255.255.255 (196.0.0.0/8)
* 197.0.0.0 - 197.255.255.255 (197.0.0.0/8)
* 198.0.0.0 - 198.255.255.255 (198.0.0.0/8)
* 199.0.0.0 - 199.255.255.255 (199.0.0.0/8)
* 200.0.0.0 - 200.255.255.255 (200.0.0.0/8)
* 201.0.0.0 - 201.255.255.255 (201.0.0.0/8)
* 202.0.0.0 - 202.255.255.255 (202.0.0.0/8)
* 203.0.0.0 - 203.255.255.255 (203.0.0.0/8)
* 204.0.0.0 - 204.255.255.255 (204.0.0.0/8)
* 205.0.0.0 - 205.255.255.255 (205.0.0.0/8)
* 206.0.0.0 - 206.255.255.255 (206.0.0.0/8)
* 207.0.0.0 - 207.255.255.255 (207.0.0.0/8)
* 208.0.0.0 - 208.255.255.255 (208.0.0.0/8)
* 209.0.0.0 - 209.255.255.255 (209.0.0.0/8)
* 210.0.0.0 - 210.255.255.255 (210.0.0.0/8)
* 211.0.0.0 - 211.255.255.255 (211.0.0.0/8)
* 212.0.0.0 - 212.255.255.255 (212.0.0.0/8)
* 213.0.0.0 - 213.255.255.255 (213.0.0.0/8)
* 214.0.0.0 - 214.255.255.255 (214.0.0.0/8)
* 215.0.0.0 - 215.255.255.255 (215.0.0.0/8)
* 216.0.0.0 - 216.255.255.255 (216.0.0.0/8)
* 217.0.0.0 - 217.255.255.255 (217.0.0.0/8)
* 218.0.0.0 - 218.255.255.255 (218.0.0.0/8)
* 219.0.0.0 - 219.255.255.255 (219.0.0.0/8)
* 220.0.0.0 - 220.255.255.255 (220.0.0.0/8)
* 221.0.0.0 - 221.255.255.255 (221.0.0.0/8)
* 222.0.0.0 - 222.255.255.255 (222.0.0.0/8)
* 223.0.0.0 - 223.255.255.255 (223.0.0.0/8)
* 224.0.0.0 - 224.255.255.255 (224.0.0.0/8)
* 225.0.0.0 - 225.255.255.255 (225.0.0.0/8)
* 226.0.0.0 - 226.255.255.255 (226.0.0.0/8)
* 227.0.0.0 - 227.255.255.255 (227.0.0.0/8)
* 228.0.0.0 - 228.255.255.255 (228.0.0.0/8)
* 229.0.0.0 - 229.255.255.255 (229.0.0.0/8)
* 230.0.0.0 - 230.255.255.255 (230.0.0.0/8)
* 231.0.0.0 - 231.255.255.255 (231.0.0.0/8)
* 232.0.0.0 - 232.255.255.255 (232.0.0.0/8)
* 233.0.0.0 - 233.255.255.255 (233.0.0.0/8)
* 234.0.0.0 - 234.255.255.255 (234.0.0.0/8)
* 235.0.0.0 - 235.255.255.255 (235.0.0.0/8)
* 236.0.0.0 - 236.255.255.255 (236.0.0.0/8)
* 237.0.0.0 - 237.255.255.255 (237.0.0.0/8)
* 238.0.0.0 - 238.255.255.255 (238.0.0.0/8)
* 239.0.0.0 - 239.255.255.255 (239.0.0.0/8)
* 240.0.0.0 - 240.255.255.255 (240.0.0.0/8)
* 241.0.0.0 - 241.255.255.255 (241.0.0.0/8)
* 242.0.0.0 - 242.255.255.255 (242.0.0.0/8)
* 243.0.0.0 - 243.255.255.255 (243.0.0.0/8)
* 244.0.0.0 - 244.255.255.255 (244.0.0.0/8)
* 245.0.0.0 - 245.255.255.255 (245.0.0.0/8)
* 246.0.0.0 - 246.255.255.255 (246.0.0.0/8)
* 247.0.0.0 - 247.255.255.255 (247.0.0.0/8)
* 248.0.0.0 - 248.255.255.255 (248.0.0.0/8)
* 249.0.0.0 - 249.255.255.255 (249.0.0.0/8)
* 250.0.0.0 - 250.255.255.255 (250.0.0.0/8)
* 251.0.0.0 - 251.255.255.255 (251.0.0.0/8)
* 252.0.0.0 - 252.255.255.255 (252.0.0.0/8)
* 253.0.0.0 - 253.255.255.255 (253.0.0.0/8)
* 254.0.0.0 - 254.255.255.255 (254.0.0.0/8)
* 255.0.0.0 - 255.255.255.255 (255.0.0.0/8)